PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002120-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 361aa    MW: 39205.3 Da    PI: 9.2692
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002120-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.6e-204489147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
    NNU_002120-RA 44 KGPWSPEEDEALQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 89
                     79******************************.***********985 PP

2Myb_DNA-binding57.14.1e-1898140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
    NNU_002120-RA  98 AFTPEEDETIIKAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 140
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.6923994IPR017930Myb domain
SuperFamilySSF466891.46E-3241137IPR009057Homeodomain-like
SMARTSM007176.4E-184392IPR001005SANT/Myb domain
PfamPF002491.7E-194489IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-274597IPR009057Homeodomain-like
CDDcd001677.13E-174688No hitNo description
SMARTSM007172.7E-1595143IPR001005SANT/Myb domain
PROSITE profilePS5129422.22396145IPR017930Myb domain
CDDcd001671.94E-1298141No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2498144IPR009057Homeodomain-like
PfamPF002493.4E-1598140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MTGHDNRLSR RIRLPDLGLE FLTRGSIDLS YSMSSSRKDV DRIKGPWSPE EDEALQKLVQ  60
KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL SPQVEHRAFT PEEDETIIKA HAKFGNKWAT  120
IARLLSGRTD NAIKNHWNST LKRKCSSVTE DSGVDGHASQ PLKRSVSAGA AIPPVSALYL  180
SSPSSPSGSD VSDSSLPVMS SSHVYRPVAR TGGILPPQQP PQPQLETSSS TNDPPTCLSL  240
SLPGADSCEV SNHVSGSNHA PNPPNTSHLV SPLSLPPPAA VLLQQVSPAP HHTQFNEFAS  300
PAGPVEKPFM PFSTEFLSVM HEMIKKEVRN YMSGLEQKGL CLQADGIRNA AVKRIGISKI  360
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-41431443104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-41431443104C-Myb DNA-Binding Domain
1msf_C1e-41431443104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271172.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW17e-94MYB44_ARATH; Transcription factor MYB44
TrEMBLF6HSY71e-163F6HSY7_VITVI; Putative uncharacterized protein
STRINGVIT_07s0129g01050.t011e-162(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-83myb domain protein 73